GLP-1(7-36) amide vs TFF3
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and TFF3 (Trefoil Factor 3 (intestinal trefoil factor)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | TFF3 |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Trefoil Factor 3 (intestinal trefoil factor) |
| Molecular Weight | 3297.7 Da | 6370 Da |
| Half-Life | 1-2 min | unknown; likely short in circulation |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 59 |
| Typical Dose | pM-nM physiologic range|research-dependent | research-only; model-dependent microgram to milligram ranges |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral/Intrarectal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 70 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
TFF3 Benefits
- ✓epithelial-restitution
- ✓mucus-support
- ✓wound-healing
- ✓barrier-stability
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
TFF3 Dosing
preclinical dosing varies widely by model|local or systemic administration|repeated dosing for inflammatory injury studies
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
TFF3 Side Effects
- ⚠limited human dosing data
- ⚠protein stability issues
- ⚠potential immunogenicity with exogenous use
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
TFF3
TFF3 is a well-established mucosal repair factor in the literature, especially in the context of intestinal injury and inflammation. Experimental studies support a role in accelerating restitution and protecting the epithelial surface in gut disease models.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.