GLP-1(7-36) amide vs Teduglutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Teduglutide (Teduglutide (glycyl-2 human glucagon-like peptide-2 analog)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Teduglutide |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Teduglutide (glycyl-2 human glucagon-like peptide-2 analog) |
| Molecular Weight | 3297.7 Da | 3752 Da |
| Half-Life | 1-2 min | approximately 2-3 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 33 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.05 mg/kg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 300 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Teduglutide Benefits
- ✓mucosal-growth
- ✓absorption-support
- ✓barrier-repair
- ✓intestinal-adaptation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Teduglutide Dosing
0.05 mg/kg once daily subcutaneous injection|chronic maintenance dosing in approved use|monitor fluid status and intestinal anatomy
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Teduglutide Side Effects
- ⚠abdominal pain
- ⚠fluid retention
- ⚠polyp/neoplasia monitoring needed
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Teduglutide
Teduglutide has robust clinical evidence showing improved intestinal absorption and reduced parenteral nutrition dependence in short bowel syndrome. Its mechanism, via GLP-2 receptor activation, makes it highly relevant to mucosal healing and intestinal adaptation research.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.