GLP-1(7-36) amide

Glucagon-like peptide-1 (7-36) amide

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Amino Acids · MW: 3297.7 Da

Ask AI About This

Amino Acids

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Molecular Weight

3297.7 Da

Half-life

1-2 min

Research Score

5.0

Studies

Storage

Store lyophilized at -20°C, reconstituted at 2-8°C

What is GLP-1(7-36) amide?

An endogenous incretin peptide released from intestinal L-cells after nutrient intake. It enhances glucose-dependent insulin secretion and slows gastric emptying, making it one of the most important gut hormones in metabolism research.

Key Benefits & Mechanisms

glucose-dependent insulin secretion

gastric emptying delay

satiety signaling

Research Summary

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Related Peptides

Cholecystokinin-8

Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)

A bioactive fragment of cholecystokinin that is widely used to study GI hormone signaling. It stimulates gallbladder contraction and pancreatic enzyme secretion and is a major satiety-related gut peptide.

Endocrine Peptides

Atrial Natriuretic Peptide (ANP-28)

Human Atrial Natriuretic Peptide

Endogenous cardiac hormone released mainly from atrial myocytes in response to stretch. It promotes natriuresis, diuresis, and vasodilation via NPR-A/guanylyl cyclase signaling.

Endocrine Peptides

B-Type Natriuretic Peptide (BNP-32)

Human B-Type Natriuretic Peptide

Endogenous peptide hormone produced predominantly by ventricular myocardium under stretch/stress. It is a major clinical biomarker for heart failure and a potent activator of NPR-A/cGMP pathways.

Endocrine Peptides

C-Type Natriuretic Peptide (CNP-22)

Human C-Type Natriuretic Peptide

Endogenous natriuretic peptide expressed in the brain, vascular endothelium, and other tissues. It preferentially signals through NPR-B to raise cGMP and support vascular and skeletal biology.

Endocrine Peptides