GLP-1(7-36) amide vs Linaclotide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Linaclotide (Linaclotide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Linaclotide |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Linaclotide |
| Molecular Weight | 3297.7 Da | 1526.8 Da |
| Half-Life | 1-2 min | Active locally; negligible systemic half-life |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 14 |
| Typical Dose | pM-nM physiologic range|research-dependent | 72-290 mcg once daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1200 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Linaclotide Benefits
- ✓improves-bowel-movements
- ✓reduces-abdominal-pain
- ✓increases-intestinal-secretion
- ✓supports-transit
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Linaclotide Dosing
72 mcg PO daily|145 mcg PO daily|290 mcg PO daily
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Linaclotide Side Effects
- ⚠diarrhea
- ⚠abdominal-pain
- ⚠bloating
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Linaclotide
Linaclotide has extensive clinical evidence for chronic idiopathic constipation and IBS-C, with consistent effects on stool frequency and abdominal symptom relief. Its mechanism is local GC-C activation in the gut with minimal systemic exposure.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.