GLP-1(7-36) amide vs Plecanatide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Plecanatide (Plecanatide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Plecanatide |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Plecanatide |
| Molecular Weight | 3297.7 Da | Approx. 1620 Da |
| Half-Life | 1-2 min | Local intestinal action; systemic half-life not clinically meaningful |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 16 |
| Typical Dose | pM-nM physiologic range|research-dependent | 3 mg once daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 350 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Plecanatide Benefits
- ✓improves-stool-frequency
- ✓supports-fluid-secretion
- ✓may-reduce-constipation
- ✓local-gut-action
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Plecanatide Dosing
3 mg PO daily|take with or without food|avoid when dehydrated
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Plecanatide Side Effects
- ⚠diarrhea
- ⚠abdominal-discomfort
- ⚠nausea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Plecanatide
Clinical trials show plecanatide improves constipation outcomes with a generally favorable tolerability profile. Like linaclotide, it acts locally in the intestinal lumen via GC-C signaling rather than systemic hormone effects.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.