GLP-1(7-36) amide vs Larazotide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Larazotide (Larazotide acetate (AT-1001)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Larazotide |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Larazotide acetate (AT-1001) |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | short; designed for local gut action |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 8 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.5-4 mg TID (clinical studies) |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 40 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Larazotide Benefits
- ✓tight-junction-support
- ✓reduced-permeability
- ✓symptom-reduction
- ✓barrier-protection
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Larazotide Dosing
0.5-4 mg orally before meals in clinical trials|typically three times daily|short-course or chronic study protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Larazotide Side Effects
- ⚠headache
- ⚠nausea
- ⚠abdominal discomfort
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Larazotide
Clinical and translational studies suggest larazotide can reduce antigen passage across the epithelium and improve gut barrier function. It is one of the better-known peptides for intestinal permeability and barrier-focused gastrointestinal therapy.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.