Tesofensine vs GLP-1(7-36) amide
Head-to-head comparison of Tesofensine (Tesofensine (NS2330)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Tesofensine | GLP-1(7-36) amide |
|---|---|---|
| Category | Weight Management | Endocrine Peptides |
| Full Name | Tesofensine (NS2330) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 426.52 g/mol | 3297.7 Da |
| Half-Life | ~200-300 hours | 1-2 min |
| Amino Acids | Small molecule | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >98% | ≥98% |
| Studies Count | 35 | 99 |
| Research Status | Phase III Clinical Trials | Endogenous |
Tesofensine Benefits
- ✓Potent appetite suppression, increased metabolic rate, enhanced thermogenesis, improved mood during dieting, reduces food reward-seeking behavior
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Tesofensine Dosing
Clinical doses: 0.25-1.0 mg orally once daily. Research typically uses 0.5 mg. Extremely long half-life (8-13 days) means steady-state in 7-10 days.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Tesofensine Side Effects
- ⚠Dry mouth, insomnia, constipation, increased heart rate, elevated blood pressure. Not recommended with uncontrolled hypertension.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Tesofensine
Phase II trials showed 12.8 kg average weight loss at 1.0 mg dose over 6 months. Simultaneously inhibits reuptake of norepinephrine, dopamine, and serotonin, producing appetite suppression and increased thermogenesis.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.