GLP-1(7-36) amide vs Pemvidutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Pemvidutide (Pemvidutide (ALT-801), long-acting glucagon-like peptide-1/glucagon receptor dual agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Pemvidutide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Pemvidutide (ALT-801), long-acting glucagon-like peptide-1/glucagon receptor dual agonist |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | Approximately 1 week |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | Trial-dependent; once-weekly SC titration |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 18 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Pemvidutide Benefits
- ✓appetite suppression
- ✓body-weight reduction
- ✓improved liver-fat markers
- ✓better glycemic control
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Pemvidutide Dosing
once-weekly subcutaneous injection|gradual dose escalation|maintenance at tolerated trial dose
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Pemvidutide Side Effects
- ⚠nausea
- ⚠vomiting
- ⚠diarrhea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Pemvidutide
Clinical studies have reported dose-dependent weight loss and favorable effects on liver fat and transaminases. It remains investigational and is not approved for obesity treatment.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.