GLP-1(7-36) amide vs Dulaglutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Dulaglutide (Recombinant GLP-1 receptor agonist Fc fusion protein) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Dulaglutide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Recombinant GLP-1 receptor agonist Fc fusion protein |
| Molecular Weight | 3297.7 Da | ~63,000 Da |
| Half-Life | 1-2 min | About 5 days |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.75-4.5 mg weekly |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 700 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Dulaglutide Benefits
- ✓modest weight loss
- ✓lower A1c
- ✓weekly dosing convenience
- ✓cardiometabolic benefit
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Dulaglutide Dosing
0.75-4.5 mg SC weekly|Increase based on response and tolerance|Administer on the same day each week
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Dulaglutide Side Effects
- ⚠nausea
- ⚠diarrhea
- ⚠injection-site reactions
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Dulaglutide
Dulaglutide has repeatedly shown small-to-moderate reductions in body weight alongside glycemic improvement in large diabetes trials. It is a useful comparator for GLP-1 receptor agonist effects on appetite and weight.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.