GLP-1(7-36) amide vs Mazdutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Mazdutide (IBI362, long-acting GLP-1 receptor and glucagon receptor dual agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Mazdutide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | IBI362, long-acting GLP-1 receptor and glucagon receptor dual agonist |
| Molecular Weight | 3297.7 Da | ~5,000 Da |
| Half-Life | 1-2 min | 5-7 days |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 37 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-6 mg weekly in obesity trials |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 28 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Mazdutide Benefits
- ✓clinically meaningful weight loss
- ✓better glycemic control
- ✓reduced waist circumference
- ✓improved lipid profile
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Mazdutide Dosing
Once-weekly SC titration|Dose escalation every 4 weeks|Use with lifestyle modification
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Mazdutide Side Effects
- ⚠nausea
- ⚠vomiting
- ⚠constipation
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Mazdutide
Clinical programs have shown substantial reductions in body weight and improvements in cardiometabolic risk markers. It is a prominent newer dual agonist in the obesity literature.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.