GLP-1(7-36) amide vs Oxyntomodulin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Oxyntomodulin (Endogenous glucagon-like peptide 1 and glucagon co-agonist peptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Oxyntomodulin |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Endogenous glucagon-like peptide 1 and glucagon co-agonist peptide |
| Molecular Weight | 3297.7 Da | ~4,200 Da |
| Half-Life | 1-2 min | 12-15 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 37 |
| Typical Dose | pM-nM physiologic range|research-dependent | Research doses vary; commonly 100-300 mcg in small human studies |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 80 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Oxyntomodulin Benefits
- ✓reduces appetite
- ✓increases satiety
- ✓supports weight loss
- ✓improves postprandial metabolic signaling
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Oxyntomodulin Dosing
Research-only dosing|Subcutaneous or IV administration in trials|Pair with calorie restriction and monitoring
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Oxyntomodulin Side Effects
- ⚠nausea
- ⚠GI discomfort
- ⚠decreased appetite beyond target
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Oxyntomodulin
Human studies showed acute reductions in food intake and modest weight loss, helping establish the GLP-1 and glucagon co-agonism concept. It remains a foundational peptide for obesity and satiety research.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.