GLP-1(7-36) amide vs Lixisenatide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Lixisenatide (Exendin-4-derived GLP-1 receptor agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Lixisenatide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Exendin-4-derived GLP-1 receptor agonist |
| Molecular Weight | 3297.7 Da | 4858 Da |
| Half-Life | 1-2 min | 2-4 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 44 |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-20 mcg daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 400 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Lixisenatide Benefits
- ✓postprandial glucose control
- ✓modest weight loss
- ✓appetite reduction
- ✓short-acting option
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Lixisenatide Dosing
10 mcg SC daily for 14 days|Increase to 20 mcg daily|Inject before the first meal of the day
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Lixisenatide Side Effects
- ⚠nausea
- ⚠vomiting
- ⚠hypoglycemia when combined with insulin
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Lixisenatide
Lixisenatide produces small but measurable weight loss in diabetes trials while improving postprandial glucose excursions. Its shorter half-life makes it a useful reference compound for first-generation incretin mimetics.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.