GLP-1(7-36) amide vs Cotadutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Cotadutide (MEDI0382, long-acting GLP-1 and glucagon receptor dual agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Cotadutide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | MEDI0382, long-acting GLP-1 and glucagon receptor dual agonist |
| Molecular Weight | 3297.7 Da | ~4,700 Da |
| Half-Life | 1-2 min | Approximately 24 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 37 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.3-3 mg daily in clinical studies |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 18 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Cotadutide Benefits
- ✓body-weight reduction
- ✓improved insulin sensitivity
- ✓reduced hepatic fat
- ✓appetite suppression
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Cotadutide Dosing
Once-daily SC in trials|Start low and titrate based on tolerance|Monitor GI adverse effects
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Cotadutide Side Effects
- ⚠nausea
- ⚠vomiting
- ⚠diarrhea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Cotadutide
Phase 2 studies reported dose-dependent weight loss and favorable changes in glycemic and liver-related markers. It is one of the most cited synthetic dual-agonist peptides for obesity research.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.