GLP-1(7-36) amide vs BI 456906
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and BI 456906 (BI 456906, glucagon-like peptide-1/glucagon receptor dual agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | BI 456906 |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | BI 456906, glucagon-like peptide-1/glucagon receptor dual agonist |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | Approximately 1 week |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | Trial-dependent; weekly SC dosing |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 10 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
BI 456906 Benefits
- ✓weight reduction
- ✓improved glucose control
- ✓lower liver-fat burden
- ✓enhanced satiety
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
BI 456906 Dosing
once-weekly subcutaneous injection|stepwise titration|ongoing maintenance phase
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
BI 456906 Side Effects
- ⚠nausea
- ⚠abdominal discomfort
- ⚠diarrhea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
BI 456906
Preclinical and early clinical research support meaningful metabolic effects with a tolerable safety profile. It remains investigational and is not commercially available.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.