GLP-1(7-36) amide vs Efinopegdutide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Efinopegdutide (Efinopegdutide (HM12525A), long-acting glucagon-like peptide-1/glucagon receptor dual agonist) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Efinopegdutide |
|---|---|---|
| Category | Endocrine Peptides | Weight Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Efinopegdutide (HM12525A), long-acting glucagon-like peptide-1/glucagon receptor dual agonist |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | Approximately 1 week |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | Trial-dependent; weekly SC dosing |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 14 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Efinopegdutide Benefits
- ✓reduced body weight
- ✓improved insulin sensitivity
- ✓reduced liver fat
- ✓greater satiety
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Efinopegdutide Dosing
once-weekly subcutaneous injection|dose escalation during lead-in|maintenance dosing in trials
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Efinopegdutide Side Effects
- ⚠nausea
- ⚠decreased appetite
- ⚠fatigue
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Efinopegdutide
Human trials have shown meaningful weight loss and improvements in hepatic steatosis biomarkers. It remains a research compound with ongoing development in metabolic disease.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.