Secretin vs GLP-1(7-36) amide

Head-to-head comparison of Secretin (Human Secretin) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertySecretinGLP-1(7-36) amide
CategoryGastrointestinalEndocrine Peptides
Full NameHuman SecretinGlucagon-like peptide-1 (7-36) amide
Molecular Weight3055.4 Da3297.7 Da
Half-Life5-7 minutes1-2 min
Amino Acids27HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Dose0.2 mcg/kg IVpM-nM physiologic range|research-dependent
RouteIntravenousendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count80099
Research StatusClinicalEndogenous

Secretin Benefits

  • stimulates-pancreatic-secretion
  • supports-bicarbonate-release
  • aids-duodenal-pH-control
  • helps-digestive-coordination

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

Secretin Dosing

0.2 mcg/kg IV diagnostic dose|research infusion protocols|short bolus administration

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

Secretin Side Effects

  • flushing
  • nausea
  • abdominal-cramping

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

Secretin

Secretin is a classic GI hormone with extensive physiology literature and established diagnostic use. It remains important for studying pancreatic secretory function, biliary responses, and duodenal feedback.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Secretin stacks with:

pancreatic-enzymesacid-controlmeal-timing

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
pancreatic-secretionbicarbonateduodenal-hormonedigestiongut-hormoneincretinendocrine-peptide