Secretin vs GLP-1(7-36) amide
Head-to-head comparison of Secretin (Human Secretin) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Secretin | GLP-1(7-36) amide |
|---|---|---|
| Category | Gastrointestinal | Endocrine Peptides |
| Full Name | Human Secretin | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 3055.4 Da | 3297.7 Da |
| Half-Life | 5-7 minutes | 1-2 min |
| Amino Acids | 27 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 0.2 mcg/kg IV | pM-nM physiologic range|research-dependent |
| Route | Intravenous | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 800 | 99 |
| Research Status | Clinical | Endogenous |
Secretin Benefits
- ✓stimulates-pancreatic-secretion
- ✓supports-bicarbonate-release
- ✓aids-duodenal-pH-control
- ✓helps-digestive-coordination
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Secretin Dosing
0.2 mcg/kg IV diagnostic dose|research infusion protocols|short bolus administration
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Secretin Side Effects
- ⚠flushing
- ⚠nausea
- ⚠abdominal-cramping
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Secretin
Secretin is a classic GI hormone with extensive physiology literature and established diagnostic use. It remains important for studying pancreatic secretory function, biliary responses, and duodenal feedback.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.