GLP-1(7-36) amide vs Trefoil factor 2
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Trefoil factor 2 (Trefoil factor 2 (Spasmolytic Polypeptide)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Trefoil factor 2 |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Trefoil factor 2 (Spasmolytic Polypeptide) |
| Molecular Weight | 3297.7 Da | ≈11–12 kDa |
| Half-Life | 1-2 min | Unknown |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 106 |
| Typical Dose | pM-nM physiologic range|research-dependent | none established |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | oral/enteral|research-only |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 80 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Trefoil factor 2 Benefits
- ✓epithelial restitution
- ✓barrier protection
- ✓ulcer healing
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Trefoil factor 2 Dosing
No established clinical dose|preclinical only
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Trefoil factor 2 Side Effects
- ⚠limited human data
- ⚠theoretical growth-factor concerns
- ⚠GI discomfort
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Trefoil factor 2
TFF2 strengthens mucus-barrier repair and epithelial restitution after gastric injury in experimental systems, making it a well-known gastric-protective peptide.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.