GLP-1(7-36) amide vs Motilin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Motilin (Motilin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Motilin |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Motilin |
| Molecular Weight | 3297.7 Da | ~2.7 kDa |
| Half-Life | 1-2 min | ~20 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 22 |
| Typical Dose | pM-nM physiologic range|research-dependent | No standard approved dose; experimental use only |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | IV|SC |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 81 |
| Research Status | Endogenous | Endogenous |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Motilin Benefits
- ✓migrating motor complex support
- ✓gastric emptying
- ✓small-bowel clearance
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Motilin Dosing
0.1–1 mg (experimental)|IV/SC
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Motilin Side Effects
- ⚠cramping
- ⚠nausea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Motilin
Motilin is a 22-amino-acid peptide released from the upper small intestine and is one of the classic physiologic prokinetic signals. It is a real peptide target for GI motility research, though not commonly used as a standard drug.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.