GLP-1(7-36) amide vs Glucagon-like peptide-2
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Glucagon-like peptide-2 (Glucagon-like peptide-2) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Glucagon-like peptide-2 |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Glucagon-like peptide-2 |
| Molecular Weight | 3297.7 Da | ~3.7 kDa |
| Half-Life | 1-2 min | ~7 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 33 |
| Typical Dose | pM-nM physiologic range|research-dependent | Research-only dosing varies; native peptide is not routinely used clinically |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC|IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 90 |
| Research Status | Endogenous | Endogenous |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Glucagon-like peptide-2 Benefits
- ✓mucosal trophic support
- ✓intestinal barrier repair
- ✓nutrient absorption support
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Glucagon-like peptide-2 Dosing
0.5–2 mg/day (research)|SC/IV
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Glucagon-like peptide-2 Side Effects
- ⚠nausea
- ⚠abdominal fullness
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Glucagon-like peptide-2
Native GLP-2 is a key enteric growth factor with rapid degradation by DPP-4. Its therapeutic value is best known through GLP-2 analog development, but the native peptide itself is a real GI-relevant hormone.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.