MK-677 vs GLP-1(7-36) amide
Head-to-head comparison of MK-677 (Ibutamoren Mesylate (MK-677)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | MK-677 | GLP-1(7-36) amide |
|---|---|---|
| Category | Growth Hormone | Endocrine Peptides |
| Full Name | Ibutamoren Mesylate (MK-677) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 528.662 g/mol | 3297.7 Da |
| Half-Life | ~24 hours | 1-2 min |
| Amino Acids | Non-peptide compound | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >99% | ≥98% |
| Studies Count | 120 | 99 |
| Research Status | Active Research | Endogenous |
MK-677 Benefits
- ✓Oral GH secretagogue, 24-hour GH elevation, increases IGF-1, improves sleep quality, increases lean mass, does not suppress natural GH
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
MK-677 Dosing
10-25 mg orally once daily before bedtime. 25 mg is the most studied dose. Can be used long-term without cycling.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
MK-677 Side Effects
- ⚠Increased appetite, mild water retention, drowsiness, transient numbness, mild increase in fasting blood glucose with long-term use.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
MK-677
A landmark 2-year study in elderly adults demonstrated significant increases in lean mass, GH pulsatility, and IGF-1 to youthful ranges. Selectively agonizes GHS-R1a without increasing cortisol or prolactin.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.