GLP-1(7-36) amide vs hGHRH(1-44)
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and hGHRH(1-44) (Human growth hormone-releasing hormone (1-44) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | hGHRH(1-44) |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human growth hormone-releasing hormone (1-44) amide |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | 5-15 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 44 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-1 mcg/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 120 |
| Research Status | Endogenous | Clinical Research |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
hGHRH(1-44) Benefits
- ✓physiologic GH pulse support
- ✓IGF-1 pathway stimulation
- ✓pituitary receptor mapping
- ✓endocrine research tool
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
hGHRH(1-44) Dosing
0.1-1 mcg/kg SC or IV bolus for stimulation studies|single-dose endocrine challenge with timed GH sampling|pulsatile administration in clamp/infusion experiments
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
hGHRH(1-44) Side Effects
- ⚠flushing
- ⚠headache
- ⚠transient nausea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
hGHRH(1-44)
Human GHRH(1-44) amide has been used extensively to characterize hypothalamic control of pituitary somatotrophs and the downstream GH/IGF-1 axis. It remains a standard comparator in studies of GHRH agonism, secretion dynamics, and receptor pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.