GLP-1(7-36) amide vs Anamorelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Anamorelin (Anamorelin hydrochloride (ONO-7643)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Anamorelin |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Anamorelin hydrochloride (ONO-7643) |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | about 9 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 50 mg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 95 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Anamorelin Benefits
- ✓stimulates appetite
- ✓raises IGF-1
- ✓may support weight gain
- ✓oral dosing
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Anamorelin Dosing
50 mg orally once daily|often studied with food or per protocol|track weight, appetite, and glucose markers
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Anamorelin Side Effects
- ⚠hyperglycemia
- ⚠peripheral edema
- ⚠constipation or nausea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Anamorelin
Trials in cachexia populations showed increased appetite and modest gains in body weight and IGF-1. Regulatory progress has varied by region, but it remains a well-studied ghrelin agonist in the GH space.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.