GLP-1(7-36) amide vs L-692,429
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and L-692,429 (L-692,429) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | L-692,429 |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | L-692,429 |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | unknown / study-dependent |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.03-0.1 mg/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 30 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
L-692,429 Benefits
- ✓potent GHSR agonism
- ✓oral bioactivity in models
- ✓validates ghrelin pathway
- ✓useful research probe
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
L-692,429 Dosing
0.03-0.1 mg/kg in early studies|single oral or short-course research dosing|serial GH sampling recommended
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
L-692,429 Side Effects
- ⚠increased appetite
- ⚠glucose intolerance
- ⚠transient prolactin changes
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
L-692,429
L-692,429 was important in early GH secretagogue research because it showed that nonpeptide molecules could trigger robust GH release. It remains a classic tool compound for studying receptor-mediated GH pulsatility and appetite signaling.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.