GLP-1(7-36) amide vs Macimorelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Macimorelin (Macimorelin acetate (AEZS-130)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Macimorelin |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Macimorelin acetate (AEZS-130) |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | about 4-6 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.5 mg/kg single oral dose |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 120 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Macimorelin Benefits
- ✓diagnostic GH stimulation
- ✓single oral dose
- ✓rapid measurable GH response
- ✓high clinical utility
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Macimorelin Dosing
0.5 mg/kg orally as a single dose|fasted testing conditions|serial GH sampling after administration
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Macimorelin Side Effects
- ⚠dysgeusia or taste disturbance
- ⚠nausea
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Macimorelin
Macimorelin has been validated in clinical testing as an oral alternative to injectable GH stimulation tests. Its short-term use makes it a useful translational tool for evaluating pituitary GH reserve.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.