GLP-1(7-36) amide vs Capromorelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Capromorelin (Capromorelin hydrochloride) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Capromorelin |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Capromorelin hydrochloride |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | about 2-3 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.25-2 mg/kg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 55 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Capromorelin Benefits
- ✓GH secretagogue activity
- ✓appetite stimulation
- ✓oral administration
- ✓translational animal model utility
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Capromorelin Dosing
0.25-2 mg/kg orally in studies|once-daily or protocol-specific dosing|monitor appetite and body weight
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Capromorelin Side Effects
- ⚠increased appetite
- ⚠vomiting or nausea
- ⚠lethargy
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Capromorelin
Research consistently shows capromorelin activates the ghrelin receptor pathway and increases food intake. Human development has been less prominent than veterinary use, but the compound remains a relevant GH secretagogue prototype.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.