GLP-1(7-36) amide vs Ibutamoren
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Ibutamoren (Ibutamoren mesylate (MK-677)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Ibutamoren |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Ibutamoren mesylate (MK-677) |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | about 24 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-25 mg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 180 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Ibutamoren Benefits
- ✓raises GH/IGF-1
- ✓increases appetite
- ✓supports lean mass retention
- ✓oral non-peptide secretagogue
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Ibutamoren Dosing
10-25 mg orally once daily|take consistently at the same time each day|monitor fasting glucose and edema in longer studies
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Ibutamoren Side Effects
- ⚠increased appetite
- ⚠water retention/edema
- ⚠somnolence or lethargy
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ibutamoren
Clinical studies show oral ibutamoren reliably elevates GH and IGF-1 over 24 hours with once-daily dosing. Body composition and appetite effects vary by population, and development has been limited by metabolic side effects.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.