L-692,429 vs hGHRH(1-40)OH

Head-to-head comparison of L-692,429 (L-692,429) and hGHRH(1-40)OH (Human growth hormone-releasing factor (1-40) hydroxyl) — benefits, dosing, side effects, research data, and where to buy.

Research Score

PropertyL-692,429hGHRH(1-40)OH
CategoryGrowth HormoneGrowth Hormone
Full NameL-692,429Human growth hormone-releasing factor (1-40) hydroxyl
Molecular WeightN/AN/A
Half-Lifeunknown / study-dependent5-20 minutes
Amino AcidsN/A40
Typical Dose0.03-0.1 mg/kg1-2 mcg/kg
RouteOralSubcutaneous/IV
Purity≥98%≥98%
Studies Count3085
Research StatusPre-clinicalClinical Research

L-692,429 Benefits

  • potent GHSR agonism
  • oral bioactivity in models
  • validates ghrelin pathway
  • useful research probe

hGHRH(1-40)OH Benefits

  • GH secretion research
  • fragment-activity comparison
  • receptor binding studies
  • axis physiology modeling

L-692,429 Dosing

0.03-0.1 mg/kg in early studies|single oral or short-course research dosing|serial GH sampling recommended

hGHRH(1-40)OH Dosing

1-2 mcg/kg SC or IV in acute research settings|single-bolus GH stimulation protocols|repeated low-dose administration in comparative studies

L-692,429 Side Effects

  • increased appetite
  • glucose intolerance
  • transient prolactin changes

hGHRH(1-40)OH Side Effects

  • flushing
  • headache
  • lightheadedness

Research Overview

L-692,429

L-692,429 was important in early GH secretagogue research because it showed that nonpeptide molecules could trigger robust GH release. It remains a classic tool compound for studying receptor-mediated GH pulsatility and appetite signaling.

hGHRH(1-40)OH

Human GHRF(1-40)OH has been studied to understand how truncation of the native hormone changes biological potency and half-life. It is a common research tool for mapping minimal active sequences within the GHRH family.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

L-692,429 stacks with:

Receptor assaysEndocrine studies

hGHRH(1-40)OH stacks with:

L-arginineL-ornithineglycine
tool-compoundgh-secretagogueghrelin-pathwayghrhfragmentpituitaryresearch-peptide