GLP-1(7-36) amide vs hGHRH(1-37)OH
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and hGHRH(1-37)OH (Human growth hormone-releasing factor (1-37) hydroxyl) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | hGHRH(1-37)OH |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human growth hormone-releasing factor (1-37) hydroxyl |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | 5-20 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 37 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-2 mcg/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 60 |
| Research Status | Endogenous | Clinical Research |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
hGHRH(1-37)OH Benefits
- ✓GH release studies
- ✓minimal-sequence mapping
- ✓receptor pharmacology
- ✓peptide stability research
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
hGHRH(1-37)OH Dosing
1-2 mcg/kg SC or IV bolus|acute stimulation with serial GH assays|short-course research administration with biomarker monitoring
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
hGHRH(1-37)OH Side Effects
- ⚠flushing
- ⚠headache
- ⚠transient fatigue
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
hGHRH(1-37)OH
Human GHRF(1-37)OH has appeared in studies examining how loss of C-terminal residues affects biological activity at the GHRH receptor. It is often used alongside other fragments to define structure-activity relationships within the GHRH family.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.