GLP-1(7-36) amide vs hGHRH(1-40)OH
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and hGHRH(1-40)OH (Human growth hormone-releasing factor (1-40) hydroxyl) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | hGHRH(1-40)OH |
|---|---|---|
| Category | Endocrine Peptides | Growth Hormone |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human growth hormone-releasing factor (1-40) hydroxyl |
| Molecular Weight | 3297.7 Da | N/A |
| Half-Life | 1-2 min | 5-20 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 40 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-2 mcg/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 85 |
| Research Status | Endogenous | Clinical Research |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
hGHRH(1-40)OH Benefits
- ✓GH secretion research
- ✓fragment-activity comparison
- ✓receptor binding studies
- ✓axis physiology modeling
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
hGHRH(1-40)OH Dosing
1-2 mcg/kg SC or IV in acute research settings|single-bolus GH stimulation protocols|repeated low-dose administration in comparative studies
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
hGHRH(1-40)OH Side Effects
- ⚠flushing
- ⚠headache
- ⚠lightheadedness
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
hGHRH(1-40)OH
Human GHRF(1-40)OH has been studied to understand how truncation of the native hormone changes biological potency and half-life. It is a common research tool for mapping minimal active sequences within the GHRH family.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.