GLP-1(7-36) amide vs REGN1033
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and REGN1033 (Trevogrumab (REGN1033)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | REGN1033 |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Trevogrumab (REGN1033) |
| Molecular Weight | 3297.7 Da | ~150 kDa |
| Half-Life | 1-2 min | ~2-3 weeks |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 100-300 mg SC or equivalent trial dosing |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous / Intravenous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 60 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
REGN1033 Benefits
- ✓myostatin blockade
- ✓lean-mass preservation
- ✓muscle hypertrophy support
- ✓catabolic-state countermeasure
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
REGN1033 Dosing
SC or IV clinical-trial dosing|repeat every 2-4 weeks|dose escalation by study
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
REGN1033 Side Effects
- ⚠injection-site reactions
- ⚠headache
- ⚠fatigue
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
REGN1033
Human and animal studies indicate that myostatin neutralization can increase muscle size, though functional gains are often smaller than mass gains. Trevogrumab is part of the broader literature showing that selective myostatin inhibition can alter body composition in clinically meaningful ways.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.