GLP-1(7-36) amide vs FS315
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and FS315 (Follistatin-315 (FS315)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | FS315 |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Follistatin-315 (FS315) |
| Molecular Weight | 3297.7 Da | ~40 kDa |
| Half-Life | 1-2 min | N/A; depends on construct/delivery |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 315 |
| Typical Dose | pM-nM physiologic range|research-dependent | Research-only; no standardized human dose |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intramuscular / research expression systems |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 95 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
FS315 Benefits
- ✓activin neutralization
- ✓muscle growth signaling
- ✓anti-catabolic support
- ✓tissue repair modulation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
FS315 Dosing
Research-only recombinant/protein-expression studies|no standardized clinical dose|route varies by platform
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
FS315 Side Effects
- ⚠off-target endocrine effects
- ⚠immune response risk
- ⚠fluid balance changes
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
FS315
Follistatin-315 is a key reference isoform in studies of muscle anabolism and reproductive/endocrine biology. In muscle research, it is relevant because it suppresses activin and can indirectly blunt myostatin pathway output.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.