GLP-1(7-36) amide vs ACE-031
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and ACE-031 (ACE-031 (soluble activin receptor type IIB-Fc)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | ACE-031 |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | ACE-031 (soluble activin receptor type IIB-Fc) |
| Molecular Weight | 3297.7 Da | ~95 kDa |
| Half-Life | 1-2 min | Days to weeks |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-3 mg/kg in early studies |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 75 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
ACE-031 Benefits
- ✓myostatin/activin neutralization
- ✓lean mass gain
- ✓muscle function support
- ✓anti-catabolic effect
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
ACE-031 Dosing
Clinical studies used single or repeated SC doses|dose escalation in mg/kg|monitoring for edema/bleeding
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
ACE-031 Side Effects
- ⚠telangiectasia/vascular effects
- ⚠epistaxis
- ⚠headache/edema
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
ACE-031
ACE-031 produced increases in lean mass in early studies, but development was curtailed after safety concerns and variable efficacy. Its literature remains important because it validated activin receptor blockade as a muscle-building strategy.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.