GLP-1(7-36) amide vs BYM338
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and BYM338 (Bimagrumab (BYM338)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | BYM338 |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Bimagrumab (BYM338) |
| Molecular Weight | 3297.7 Da | ~148 kDa |
| Half-Life | 1-2 min | ~2-3 weeks |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-30 mg/kg IV in trials |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intravenous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 140 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
BYM338 Benefits
- ✓increased lean mass
- ✓functional strength support
- ✓reduced muscle wasting
- ✓metabolic body-composition shift
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
BYM338 Dosing
IV infusion|10-30 mg/kg per study cycle|repeat every 4-12 weeks
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
BYM338 Side Effects
- ⚠muscle cramps
- ⚠diarrhea/nausea
- ⚠infusion reactions
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
BYM338
Clinical trials showed meaningful increases in lean mass, with mixed functional outcomes depending on population and endpoint. The antibody remains one of the best-documented receptor-blocking approaches to muscle anabolism in humans.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.