GLP-1(7-36) amide vs Epoetin Alfa
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Epoetin Alfa (Recombinant human erythropoietin alfa) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Epoetin Alfa |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Recombinant human erythropoietin alfa |
| Molecular Weight | 3297.7 Da | ≈30,400 Da |
| Half-Life | 1-2 min | ~4-13 h IV; ~20-30 h SC |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 165 |
| Typical Dose | pM-nM physiologic range|research-dependent | 50-100 IU/kg SC 3x weekly or 40,000 IU SC weekly |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 320 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Epoetin Alfa Benefits
- ✓raises hemoglobin
- ✓increases oxygen-carrying capacity
- ✓may increase VO2 max
- ✓improves time-to-exhaustion
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Epoetin Alfa Dosing
50-100 IU/kg subcutaneous 3x weekly|40,000 IU subcutaneous weekly|Titrate to hemoglobin target under medical supervision
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Epoetin Alfa Side Effects
- ⚠hypertension
- ⚠thrombosis
- ⚠polycythemia
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Epoetin Alfa
Human studies in anemia and performance-related settings show that increasing red-cell mass can improve aerobic capacity and endurance. It remains heavily regulated because excessive erythropoiesis raises thrombotic and cardiovascular risk.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.