GLP-1(7-36) amide vs Met-enkephalin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Met-enkephalin (Tyr-Gly-Gly-Phe-Met) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Met-enkephalin |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Tyr-Gly-Gly-Phe-Met |
| Molecular Weight | 3297.7 Da | 573.67 Da |
| Half-Life | 1-2 min | 1-5 minutes in plasma |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 5 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-5 ug per animal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal / intracerebroventricular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1200 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Met-enkephalin Benefits
- ✓endogenous opioid signaling
- ✓analgesic reference ligand
- ✓spinal antinociception
- ✓neurochemical pain-pathway probe
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Met-enkephalin Dosing
Intrathecal 0.1-5 ug per animal|Intracerebroventricular 0.1-2 ug per animal|In vitro 1-100 nM
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Met-enkephalin Side Effects
- ⚠sedation at higher exposure
- ⚠constipation-like opioid effects
- ⚠rapid enzymatic degradation
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Met-enkephalin
Met-enkephalin has been extensively used in receptor pharmacology and nociception studies to map mu and delta opioid biology. The main limitation in translational work is very short half-life from peptidase cleavage and poor systemic stability.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.