GLP-1(7-36) amide vs Leu-enkephalin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Leu-enkephalin (Tyr-Gly-Gly-Phe-Leu) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Leu-enkephalin |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Tyr-Gly-Gly-Phe-Leu |
| Molecular Weight | 3297.7 Da | 555.63 Da |
| Half-Life | 1-2 min | 1-5 minutes in plasma |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 5 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-5 ug per animal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal / intracerebroventricular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1000 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Leu-enkephalin Benefits
- ✓delta-opioid activity
- ✓endogenous analgesic model
- ✓receptor-selective pharmacology
- ✓nociception pathway research
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Leu-enkephalin Dosing
Intrathecal 0.1-5 ug per animal|Intracerebroventricular 0.1-2 ug per animal|In vitro 1-100 nM
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Leu-enkephalin Side Effects
- ⚠sedation
- ⚠constipation-like opioid effects
- ⚠very short plasma stability
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Leu-enkephalin
Leu-enkephalin is a standard tool in opioid receptor and pain-transmission research because it helps distinguish delta- from mu-preferring signaling. Its research value is high, but its clinical utility is limited by rapid enzymatic breakdown and delivery challenges.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.