GLP-1(7-36) amide vs DADLE
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and DADLE ([D-Ala2, D-Leu5]-enkephalin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | DADLE |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | [D-Ala2, D-Leu5]-enkephalin |
| Molecular Weight | 3297.7 Da | 569.67 Da |
| Half-Life | 1-2 min | 5-20 minutes in plasma |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 5 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.01-2 ug per animal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal / intracerebroventricular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 450 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
DADLE Benefits
- ✓delta-opioid agonism
- ✓enhanced peptide stability
- ✓spinal analgesia models
- ✓research on tolerance mechanisms
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
DADLE Dosing
Intrathecal 0.01-2 ug per animal|Intracerebroventricular 0.01-1 ug per animal|In vitro 0.1-50 nM
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
DADLE Side Effects
- ⚠sedation
- ⚠motor suppression at higher doses
- ⚠opioid tolerance with repeated exposure
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
DADLE
DADLE has been studied for analgesic, neuroprotective, and receptor-selective opioid effects in animal and tissue models. It remains important as a mechanistic probe because it is more stable than endogenous enkephalins but still peptide-like in its delivery constraints.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.