GLP-1(7-36) amide vs Endomorphin-1
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Endomorphin-1 (Tyr-Pro-Trp-Phe-NH2) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Endomorphin-1 |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Tyr-Pro-Trp-Phe-NH2 |
| Molecular Weight | 3297.7 Da | 610.71 Da |
| Half-Life | 1-2 min | Minutes in plasma |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 4 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-10 ug per animal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal / subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 600 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Endomorphin-1 Benefits
- ✓mu-opioid selectivity
- ✓potent antinociception
- ✓endogenous peptide scaffold
- ✓useful for receptor-discovery studies
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Endomorphin-1 Dosing
Intrathecal 0.1-10 ug per animal|Subcutaneous 0.1-5 ug per animal|In vitro 0.1-100 nM
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Endomorphin-1 Side Effects
- ⚠respiratory depression at high exposure
- ⚠sedation
- ⚠tolerance and dependence potential
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Endomorphin-1
Endomorphin-1 is a key research peptide in studies of endogenous mu-opioid signaling and spinal analgesia. Like other peptide analgesics, its main translational hurdles are enzymatic instability, limited oral bioavailability, and delivery across barriers.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.