GLP-1(7-36) amide vs DPDPE
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and DPDPE ([D-Pen2, D-Pen5]-enkephalin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | DPDPE |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | [D-Pen2, D-Pen5]-enkephalin |
| Molecular Weight | 3297.7 Da | 645.79 Da |
| Half-Life | 1-2 min | 15-60 minutes in plasma |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 5 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.01-1 ug per animal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal / intracerebroventricular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 800 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
DPDPE Benefits
- ✓delta-opioid selectivity
- ✓improved conformational stability
- ✓analgesic receptor mapping
- ✓useful in chronic pain models
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
DPDPE Dosing
Intrathecal 0.01-1 ug per animal|Intracerebroventricular 0.01-0.5 ug per animal|In vitro 0.1-20 nM
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
DPDPE Side Effects
- ⚠sedation
- ⚠nausea-like opioid effects
- ⚠tolerance with repeated dosing
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
DPDPE
DPDPE is widely cited in opioid pharmacology because it helped establish the functional role of delta-opioid receptors in pain control. Its constrained structure is also used to explore how peptide cyclization changes potency, stability, and tissue selectivity.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.