Elamipretide vs GLP-1(7-36) amide
Head-to-head comparison of Elamipretide (Elamipretide (MTP-131, SS-31)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Elamipretide | GLP-1(7-36) amide |
|---|---|---|
| Category | Muscle & Performance | Endocrine Peptides |
| Full Name | Elamipretide (MTP-131, SS-31) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 639.8 Da | 3297.7 Da |
| Half-Life | 1-4 hours | 1-2 min |
| Amino Acids | 4 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 0.01-0.25 mg/kg/day | pM-nM physiologic range|research-dependent |
| Route | Subcutaneous/Intravenous | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 120 | 99 |
| Research Status | Clinical | Endogenous |
Elamipretide Benefits
- ✓mitochondrial protection
- ✓reduced oxidative stress
- ✓improved fatigue resistance
- ✓may support exercise tolerance
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Elamipretide Dosing
0.01-0.25 mg/kg/day SC (clinical research)|daily dosing in trials|alternative IV protocols in some studies
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Elamipretide Side Effects
- ⚠nausea
- ⚠injection-site reactions
- ⚠diarrhea
- ⚠headache
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Elamipretide
Clinical and translational studies show elamipretide can improve mitochondrial function and some functional endpoints in mitochondrial disorders. Skeletal muscle research suggests benefits are driven by energy metabolism rather than direct muscle-building effects.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.