GLP-1(7-36) amide vs Methoxy PEG-Epoetin Beta
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Methoxy PEG-Epoetin Beta (Methoxy polyethylene glycol-epoetin beta (CERA)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Methoxy PEG-Epoetin Beta |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Methoxy polyethylene glycol-epoetin beta (CERA) |
| Molecular Weight | 3297.7 Da | ≈60,000 Da |
| Half-Life | 1-2 min | ~130 h |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 165 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.6 mcg/kg SC every 2 weeks or 1.2 mcg/kg SC monthly |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 95 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Methoxy PEG-Epoetin Beta Benefits
- ✓long-acting erythropoiesis
- ✓stable hemoglobin
- ✓fewer injections
- ✓improved oxygen delivery
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Methoxy PEG-Epoetin Beta Dosing
0.6 mcg/kg SC every 2 weeks|1.2 mcg/kg SC monthly|Adjust based on hemoglobin
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Methoxy PEG-Epoetin Beta Side Effects
- ⚠hypertension
- ⚠thromboembolism
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Methoxy PEG-Epoetin Beta
Clinical trials show predictable hemoglobin correction with a long dosing interval and sustained red-cell stimulation. Any VO2 max effect would be secondary to higher hemoglobin, not a direct ergogenic mechanism.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.