GLP-1(7-36) amide vs Roxadustat
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Roxadustat (Roxadustat (FG-4592), hypoxia-inducible factor prolyl hydroxylase inhibitor) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Roxadustat |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Roxadustat (FG-4592), hypoxia-inducible factor prolyl hydroxylase inhibitor |
| Molecular Weight | 3297.7 Da | 352.35 Da |
| Half-Life | 1-2 min | ~12-16 h |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 70-100 mg orally three times weekly |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 180 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Roxadustat Benefits
- ✓induces endogenous EPO
- ✓improves iron handling
- ✓raises hemoglobin
- ✓may improve exercise tolerance
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Roxadustat Dosing
70-100 mg orally 3x weekly|Titrate by hemoglobin response|Monitor iron indices regularly
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Roxadustat Side Effects
- ⚠nausea
- ⚠hypertension
- ⚠thrombotic events
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Roxadustat
Large clinical studies support roxadustat for anemia, especially in chronic kidney disease populations. Direct VO2 max enhancement data in healthy athletes are limited, so its performance effects remain mostly inferential.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.