GLP-1(7-36) amide vs Darbepoetin Alfa
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Darbepoetin Alfa (Darbepoetin alfa, recombinant human erythropoiesis-stimulating protein) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Darbepoetin Alfa |
|---|---|---|
| Category | Endocrine Peptides | Muscle & Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Darbepoetin alfa, recombinant human erythropoiesis-stimulating protein |
| Molecular Weight | 3297.7 Da | ≈37,000 Da |
| Half-Life | 1-2 min | ~21 h IV; ~49 h SC |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 165 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.45 mcg/kg weekly SC or 0.75 mcg/kg every 2 weeks |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/IV |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 210 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Darbepoetin Alfa Benefits
- ✓longer-acting erythropoiesis
- ✓stable hemoglobin
- ✓increased oxygen delivery
- ✓may improve aerobic capacity
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Darbepoetin Alfa Dosing
0.45 mcg/kg weekly SC|0.75 mcg/kg every 2 weeks SC|Dose-adjust to hemoglobin response
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Darbepoetin Alfa Side Effects
- ⚠hypertension
- ⚠thromboembolism
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Darbepoetin Alfa
Clinical studies show durable hemoglobin correction with less frequent dosing than epoetin alfa. The endurance benefit, where present, would come from improved oxygen-carrying capacity rather than a direct ergogenic pathway.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.