C-peptide vs GLP-1(7-36) amide
Head-to-head comparison of C-peptide (Connecting peptide (C-peptide)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | C-peptide | GLP-1(7-36) amide |
|---|---|---|
| Category | Pain Management | Endocrine Peptides |
| Full Name | Connecting peptide (C-peptide) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 3020.3 Da | 3297.7 Da |
| Half-Life | ~20-30 min | 1-2 min |
| Amino Acids | 31 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | no approved analgesic dose|research-only | pM-nM physiologic range|research-dependent |
| Route | IV|subQ | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 46 | 99 |
| Research Status | Pre-clinical | Endogenous |
C-peptide Benefits
- ✓diabetic neuropathy research
- ✓nerve function support
- ✓possible analgesic effect
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
C-peptide Dosing
0.5-1.0 mg/day in research|route varies by protocol
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
C-peptide Side Effects
- ⚠injection-site reactions
- ⚠unknown long-term safety
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
C-peptide
C-peptide is not an approved analgesic, but multiple studies have examined its effects on peripheral nerve blood flow and neuropathy outcomes. The strongest relevance is in diabetic neuropathic pain rather than migraine.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.