C-peptide vs GLP-1(7-36) amide

Head-to-head comparison of C-peptide (Connecting peptide (C-peptide)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyC-peptideGLP-1(7-36) amide
CategoryPain ManagementEndocrine Peptides
Full NameConnecting peptide (C-peptide)Glucagon-like peptide-1 (7-36) amide
Molecular Weight3020.3 Da3297.7 Da
Half-Life~20-30 min1-2 min
Amino Acids31HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Doseno approved analgesic dose|research-onlypM-nM physiologic range|research-dependent
RouteIV|subQendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count4699
Research StatusPre-clinicalEndogenous

C-peptide Benefits

  • diabetic neuropathy research
  • nerve function support
  • possible analgesic effect

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

C-peptide Dosing

0.5-1.0 mg/day in research|route varies by protocol

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

C-peptide Side Effects

  • injection-site reactions
  • unknown long-term safety

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

C-peptide

C-peptide is not an approved analgesic, but multiple studies have examined its effects on peripheral nerve blood flow and neuropathy outcomes. The strongest relevance is in diabetic neuropathic pain rather than migraine.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

C-peptide stacks with:

C-peptideConnecting peptide

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
neuropathic-paindiabetic-neuropathynerve-repairgut-hormoneincretinendocrine-peptide