GLP-1(7-36) amide vs Somatostatin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Somatostatin (Somatostatin-14) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Somatostatin |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Somatostatin-14 |
| Molecular Weight | 3297.7 Da | 1637.85 |
| Half-Life | 1-2 min | 1-3 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 14 |
| Typical Dose | pM-nM physiologic range|research-dependent | N/A|N/A |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | IV/SC |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 84 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Somatostatin Benefits
- ✓nociceptive inhibition
- ✓anti-inflammatory signaling
- ✓visceral pain modulation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Somatostatin Dosing
N/A|N/A
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Somatostatin Side Effects
- ⚠hyperglycemia
- ⚠bradycardia
- ⚠GI upset
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Somatostatin
Somatostatin reduces release of multiple excitatory mediators and can suppress pain signaling in preclinical and limited translational work. Its analgesic use is not standard, but the peptide is real and mechanistically relevant to pain control.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.