GLP-1(7-36) amide vs Calcitonin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Calcitonin (Salmon Calcitonin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Calcitonin |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Salmon Calcitonin |
| Molecular Weight | 3297.7 Da | 3431.9 Da |
| Half-Life | 1-2 min | about 10-15 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 32 |
| Typical Dose | pM-nM physiologic range|research-dependent | 100 IU/day SC or 200 IU/day intranasal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 350 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Calcitonin Benefits
- ✓bone pain relief
- ✓short-term analgesic effect
- ✓may reduce opioid requirement
- ✓useful in osteoporotic fracture pain
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Calcitonin Dosing
100 IU subcutaneous daily|200 IU intranasal daily|short-term use in acute pain settings
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Calcitonin Side Effects
- ⚠nausea
- ⚠flushing
- ⚠rhinitis
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Calcitonin
Calcitonin has been evaluated in randomized trials and reviews for pain associated with vertebral compression fractures and other bone-related conditions. The signal is strongest for short-term analgesia rather than long-term chronic pain control.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.