GLP-1(7-36) amide vs Ziconotide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Ziconotide (ω-Conotoxin MVIIA (ziconotide)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Ziconotide |
|---|---|---|
| Category | Endocrine Peptides | Pain Management |
| Full Name | Glucagon-like peptide-1 (7-36) amide | ω-Conotoxin MVIIA (ziconotide) |
| Molecular Weight | 3297.7 Da | 2639.1 Da |
| Half-Life | 1-2 min | approximately 4.5 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 25 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.5-19.2 mcg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intrathecal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 500 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Ziconotide Benefits
- ✓strong non-opioid analgesia
- ✓effective for refractory neuropathic pain
- ✓opioid-sparing option
- ✓intrathecal delivery allows targeted action
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Ziconotide Dosing
start 0.5 mcg/day intrathecal|titrate by 0.5 mcg/day no more than 2 times weekly|max 19.2 mcg/day in labeling
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Ziconotide Side Effects
- ⚠dizziness
- ⚠confusion
- ⚠ataxia
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ziconotide
Clinical studies and post-marketing data support ziconotide as an analgesic for severe chronic pain that does not respond to conventional therapy. Research focuses on balancing analgesic efficacy with neuropsychiatric tolerability and careful dose titration.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.