GLP-1(7-36) amide vs Secretin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Secretin (Human Secretin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Secretin |
|---|---|---|
| Category | Endocrine Peptides | Gastrointestinal |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human Secretin |
| Molecular Weight | 3297.7 Da | 3055.4 Da |
| Half-Life | 1-2 min | 5-7 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 27 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.2 mcg/kg IV |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intravenous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 800 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Secretin Benefits
- ✓stimulates-pancreatic-secretion
- ✓supports-bicarbonate-release
- ✓aids-duodenal-pH-control
- ✓helps-digestive-coordination
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Secretin Dosing
0.2 mcg/kg IV diagnostic dose|research infusion protocols|short bolus administration
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Secretin Side Effects
- ⚠flushing
- ⚠nausea
- ⚠abdominal-cramping
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Secretin
Secretin is a classic GI hormone with extensive physiology literature and established diagnostic use. It remains important for studying pancreatic secretory function, biliary responses, and duodenal feedback.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.