GLP-1(7-36) amide vs PACAP-27
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and PACAP-27 (Pituitary Adenylate Cyclase-Activating Polypeptide-27) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | PACAP-27 |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Pituitary Adenylate Cyclase-Activating Polypeptide-27 |
| Molecular Weight | 3297.7 Da | 3158 Da |
| Half-Life | 1-2 min | minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 27 |
| Typical Dose | pM-nM physiologic range|research-dependent | Research-only: 0.1-1 nmol/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intraperitoneal/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 220 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
PACAP-27 Benefits
- ✓anti-apoptotic signaling
- ✓insulin secretagogue effect
- ✓reduced ER stress
- ✓islet cytoprotection
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
PACAP-27 Dosing
0.1-1 nmol/kg in animal studies|10-100 nM in vitro|research-only intermittent dosing
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
PACAP-27 Side Effects
- ⚠flushing
- ⚠hypotension at high exposure
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
PACAP-27
PACAP-27 has been repeatedly shown to support beta-cell survival through cAMP/PKA and related pathways. In experimental models it mitigates cytokine damage, preserves insulin content, and helps maintain islet viability.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.