GLP-1(7-36) amide vs Insulin Degludec
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Insulin Degludec (Insulin degludec (desB30, acylated ultra-long-acting insulin analog)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Insulin Degludec |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Insulin degludec (desB30, acylated ultra-long-acting insulin analog) |
| Molecular Weight | 3297.7 Da | 6103.9 Da |
| Half-Life | 1-2 min | More than 25 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 50 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-0.2 U/kg once daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 7000 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Insulin Degludec Benefits
- ✓Ultra-long basal coverage
- ✓Lower day-to-day variability
- ✓Reduced nocturnal hypoglycemia
- ✓Flexible dosing time
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Insulin Degludec Dosing
Inject SC once daily|Titrate to fasting glucose and HbA1c response|May be administered with flexible timing in adults
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Insulin Degludec Side Effects
- ⚠Hypoglycemia
- ⚠Injection-site reactions
- ⚠Weight gain
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Insulin Degludec
Studies highlight prolonged action and lower glycemic variability compared with many other basal insulins. It is frequently used in research on ultra-long basal coverage and hypoglycemia reduction.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.